PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000992t1
Common NameTCM_000992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 25353.8 Da    PI: 7.0642
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000992t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.61.4e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+i+n + rqvtfskRr g++KKAeELS+LCda+va++ifsstgkl+ y+s
  Thecc1EG000992t1  9 KKIDNATARQVTFSKRRRGLFKKAEELSILCDADVALVIFSSTGKLFQYAS 59
                      68***********************************************86 PP

2K-box44.18.8e-16981712598
             K-box  25 kkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                        ke+ +  +++R++ Ge+L+ Ls++eLqqLe+ Le++l+++ +kK + ++++i++lq+k   l een++L+ ++
  Thecc1EG000992t1  98 SKEVAEKSHQLRQMRGEELQGLSIEELQQLEKSLESGLSRVIEKKGQKIMREINDLQRKGMHLMEENERLKLQI 171
                       44444445889***********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.039161IPR002100Transcription factor, MADS-box
CDDcd002655.32E-39277No hitNo description
SuperFamilySSF554556.02E-31378IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-27323IPR002100Transcription factor, MADS-box
PfamPF003196.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.91987177IPR002487Transcription factor, K-box
PfamPF014867.6E-1695170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0017148Biological Processnegative regulation of translation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MAREKIQIKK IDNATARQVT FSKRRRGLFK KAEELSILCD ADVALVIFSS TGKLFQYASS  60
SMKEILERHN LHSKNLEKLE QPSLELQLVE NGNQSMLSKE VAEKSHQLRQ MRGEELQGLS  120
IEELQQLEKS LESGLSRVIE KKGQKIMREI NDLQRKGMHL MEENERLKLQ IFNGRKQIAS  180
DSEIVFGEDG QSSESVTNVC ASNGTPHDYE SSDTSLKLGL PYSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-21173173Myocyte-specific enhancer factor 2B
1tqe_Q6e-21173173Myocyte-specific enhancer factor 2B
1tqe_R6e-21173173Myocyte-specific enhancer factor 2B
1tqe_S6e-21173173Myocyte-specific enhancer factor 2B
3mu6_A6e-21372271Myocyte-specific enhancer factor 2A
3mu6_B6e-21372271Myocyte-specific enhancer factor 2A
3mu6_C6e-21372271Myocyte-specific enhancer factor 2A
3mu6_D6e-21372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047796.11e-162K-box region and MADS-box transcription factor family protein
SwissprotQ9FUY61e-112JOIN_SOLLC; MADS-box protein JOINTLESS
SwissprotQ9FVC11e-112SVP_ARATH; MADS-box protein SVP
TrEMBLA0A061DPR21e-162A0A061DPR2_THECC; K-box region and MADS-box transcription factor family protein
STRINGVIT_00s0313g00070.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-100MIKC_MADS family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]